Protein Info for PP_1907 in Pseudomonas putida KT2440

Annotation: Hydrolase, haloacid dehalogenase-like family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00702: Hydrolase" amino acids 6 to 180 (175 residues), 102.5 bits, see alignment E=1e-32 PF13419: HAD_2" amino acids 8 to 186 (179 residues), 117.2 bits, see alignment E=2.4e-37 PF12710: HAD" amino acids 9 to 176 (168 residues), 41.6 bits, see alignment E=4.8e-14 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 51 to 186 (136 residues), 41.5 bits, see alignment E=2.3e-14 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 101 to 180 (80 residues), 37 bits, see alignment E=6.5e-13 PF13242: Hydrolase_like" amino acids 141 to 210 (70 residues), 55 bits, see alignment E=1.5e-18

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 100% identity to ppu:PP_1907)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LM3 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PP_1907 Hydrolase, haloacid dehalogenase-like family (Pseudomonas putida KT2440)
MKKGYELLIFDWDGTLADSIGRIVEAMNVAAERAGEAQSSDAAVKGIIGLALDEAIHTLY
PHLAPAEVASFRQHYADVYVALDQQPSPLFDGVVESLDAFRAEGYRLAVATGKARRGLDR
VLKANGWERFFDITRAADETRGKPHPLMLEEILGHCGVEPSRALMVGDSAFDLQMASNAG
MHSVAVGYGAMSLQALAEFGPQVCIDHFSQLREWLGGSAIPLPR