Protein Info for PP_1898 in Pseudomonas putida KT2440

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 123 to 148 (26 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details PF01618: MotA_ExbB" amino acids 79 to 201 (123 residues), 112.8 bits, see alignment E=4.7e-37

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 98% identity to ppf:Pput_3816)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LN1 at UniProt or InterPro

Protein Sequence (224 amino acids)

>PP_1898 MotA/TolQ/ExbB proton channel family protein (Pseudomonas putida KT2440)
MVEWRPFSEGAFIVWELVKSGGWMMLPIILSSIAAMAIVVERLWTLRASRVTPPHLLGQV
WMWIKDKQLTSDKLKALRADSPLGEILAAGLANSRHGREIMKECIEEAASRVIHELERYI
STLGTIAAMAPLLGLLGTVLGMIDIFSAFMGSQMTANAAVLASGISKALVTTAAGLMVGI
PAVFFHRFLLRRIDELVIGMEQEAIKLVEVIQGDREVEVAGGKA