Protein Info for PP_1896 in Pseudomonas putida KT2440

Annotation: putative ABC transporter - permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 63 to 88 (26 residues), see Phobius details amino acids 108 to 134 (27 residues), see Phobius details amino acids 141 to 166 (26 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 227 to 252 (26 residues), see Phobius details PF01061: ABC2_membrane" amino acids 12 to 221 (210 residues), 137.8 bits, see alignment E=3.9e-44 PF12698: ABC2_membrane_3" amino acids 61 to 246 (186 residues), 49.3 bits, see alignment E=4.1e-17

Best Hits

Swiss-Prot: 60% identical to YADH_SHIFL: Inner membrane transport permease YadH (yadH) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 99% identity to ppg:PputGB1_1471)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LN3 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PP_1896 putative ABC transporter - permease subunit (Pseudomonas putida KT2440)
MSVELRTNWVALNTIVYREVRRFLRIWPQTLLPPAITMVLYFVIFGNLIGRQIGDMGGFT
YMQYIVPGLIMMSVITNSYGNVVSSFFGSKFQRSIEELMVSPVSPHTILVGYVLGGVLRG
LAVGVIVTILSMFFTDLQVHHLGVTVAVVLLTATIFSLLGFVNAVFARNFDDISIIPTFV
LTPLTYLGGVFYSINLLPPFWQTVSLANPVLHMVNSFRYGILGVSDISIGTAITFMLVAT
AVLYVVCVRLLVSGRGMRA