Protein Info for PP_1889 in Pseudomonas putida KT2440

Annotation: Type 1 pili subunit FimD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 831 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF13954: PapC_N" amino acids 39 to 185 (147 residues), 114.3 bits, see alignment E=7.3e-37 PF00577: Usher" amino acids 202 to 742 (541 residues), 557.4 bits, see alignment E=6.6e-171 PF13953: PapC_C" amino acids 752 to 813 (62 residues), 73.1 bits, see alignment 2e-24

Best Hits

KEGG orthology group: K07347, outer membrane usher protein (inferred from 100% identity to ppu:PP_1889)

Predicted SEED Role

"Outer membrane usher protein FIMD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LP0 at UniProt or InterPro

Protein Sequence (831 amino acids)

>PP_1889 Type 1 pili subunit FimD (Pseudomonas putida KT2440)
MVLPPLRWRTMRRQRSALLCLLGSSTLLSAPYSQADSGFQSGFLRQVPGQPQAASAWSLS
MLTSDQGLAPGRYRVEVQVNLEPAGQHELDFQPGPDGELQPCLPARLLGEWGMRLDALAN
PEDQASACLDLLTVVPGAQIVFTPTELHLAISIPQISMRRNTANQVDPSRWDSGINAAFI
NYQASTLNGRNRSSGRYTSNDLYLNSGINLGEWRLRSTQSWRQGSQGKTEWTRAQTYAQR
DIPGTLANLTIGETFTDREVFRSVPISGVRVASDMGMLADNQRGYAPIIRGVAQSRAKVE
IWQHGYPIYSTYVSAGPYAIDDLSTAGSGELEVVVTEADGQVRRFIQPYSTMSNLLRPGV
WRYSATVGRYNPSSDLETPLLWQGTLAVGSYWDTTVYGGLMASEFYRAGNLGFSKDLGHL
GAVAFDVTQASSAIDNAHEREVQGSSYALKYAKAFTTQTNLRFAGYRYSTQGYRDFDEVV
RQRSQDTTFSGSRRSRLEASVHQSLGRTSSLTLTLSQQDYWRSNATQRQYQFNFNTQHRG
VGYNLFASQSLTDRYGNDRQFGLSVTVPLHFGHRANATFDLQHNANGYSQRATLSGSDSA
RALSYSTSLSRDEHARKTAALSLGHQAPYASVSAGYTEADNYRSLSLNASGAVLLHADGL
EFGRYLGDTAALIEVPGVANVGLQNATGTRTNSRGYALLPYLQPYRTNSVVLETDRLDPD
VEIDNGIAQVVPRQGAVVKHRFEARRVSRLVLTLHDTQGQPLPFGAQVLAENGTQLGMVG
QAGLVMLTNPSQEQPLQVSWGEQPNAGCQVHLDELDAPVVDGYRQQTLTCI