Protein Info for PP_1880 in Pseudomonas putida KT2440

Annotation: Outer membrane autotransporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 730 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF03212: Pertactin" amino acids 309 to 421 (113 residues), 97.4 bits, see alignment E=6.1e-32 TIGR01414: outer membrane autotransporter barrel domain" amino acids 326 to 730 (405 residues), 355.8 bits, see alignment E=1.8e-110 PF03797: Autotransporter" amino acids 469 to 709 (241 residues), 183.2 bits, see alignment E=8e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1880)

Predicted SEED Role

"Outer membrane autotransporter barrel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LP9 at UniProt or InterPro

Protein Sequence (730 amino acids)

>PP_1880 Outer membrane autotransporter (Pseudomonas putida KT2440)
MPSRLFHALRHCSTPAHLVLAGPLFFASACWAETLVDADTQLDAGSTLDSYRVIGPAVLT
ATGATTLQIAAQAGATVNLSDSQVTAESNGNGLALNGASATVHRSTIRSDARGLALSAAG
AGNGSRALINDSVIEGGVQGATLNASSAELQRSELRGTGASSEGARLVAGTLIARDGSTI
SGGNYGARILEDDGRGSTLVVDNSLIEGRNGPAIAVGRGAGFAASAQIDVINGASLSGGN
GMLLHVAEDAAANLRVNNSHLVGDIVAASGGTANVLLENFATLKGRLDNVASLEINSGGE
WTLVDNSQVTDLSLDNGAVRFGGPGEFFTLSVENLTGNGTFIMEADFSTSQSDFLDVTGT
ASGNHQLLISASGNDPLTDNSLHVVHTAAGDSQFSLLGGSVDLGAYSYDLVQRGDNDWYL
DATTRTVSPGTQTVMALANVVPTIWYGELGVLRSRMGDVRRNPGKAGGWVRSYGNQFNVS
ATSGAAYQQQQQGLSIGADAPLAAGDGNWLVGITAGYSNSDLNLARGSSASVDSYHAGAY
ATWLDPESGYYIDTVARINRFRNQADVRLSDGSKAKGDYSNLGAGVSLEVGRHLNLADDW
FLEPFAQLSGLVVQGKDYSLDNGMRANSNSTHSLLGKVGTSVGRTFSAGTGRSVQPYLRV
AAVHEFVNDNQVKVNDNRFSSNLAGSRAEIGAGVAVAWGEKWQAHADFDYSHGSKLEQPW
GVSVGARYNW