Protein Info for PP_1862 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 7 to 36 (30 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 133 to 160 (28 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF01925: TauE" amino acids 8 to 244 (237 residues), 159.9 bits, see alignment E=4.4e-51

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to ppu:PP_1862)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LR6 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PP_1862 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MIEWLLYIVLGAALGTMGGLFGIGGGLIAIPALGVLFGLDQQLAQGTALVMVVPNVLLAL
WRYHQRNRIAFRHALPLSACSFLFAWLGSIWAVGLDAHFMRLGFVGFLVALAVWNVVRMF
MKVSPPSAELRHAWPWLGVLGSFAGTMGGLFGVGGAVVATPILTSVFGATQVVAQGLSLA
LAAPSTLVTLVTYGVHHSVDWGVGIPLAVGGLLSISWGVKLAHALPEKVLRAMFCVFLVV
CAVMLAFEL