Protein Info for PP_1858 in Pseudomonas putida KT2440

Annotation: elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 TIGR00038: translation elongation factor P" amino acids 4 to 186 (183 residues), 190.3 bits, see alignment E=1.3e-60 PF08207: EFP_N" amino acids 5 to 60 (56 residues), 72.4 bits, see alignment E=3.4e-24 PF01132: EFP" amino acids 65 to 125 (61 residues), 51.9 bits, see alignment E=8.1e-18 PF09285: Elong-fact-P_C" amino acids 132 to 186 (55 residues), 62.8 bits, see alignment E=3e-21

Best Hits

Swiss-Prot: 100% identical to EFP_PSEPK: Elongation factor P (efp) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02356, elongation factor P (inferred from 100% identity to ppf:Pput_3856)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LS0 at UniProt or InterPro

Protein Sequence (189 amino acids)

>PP_1858 elongation factor P (Pseudomonas putida KT2440)
MKTGKELKPGTVLRIDNDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTETVYGADDKL
DDVILDRKEATLSFINGDEYTFMDTTDYTMYELNAEDIEAVLPYIEEGMEDVCEAVFFEG
RLVSVELPTTISRKVVYTENAARGDTSGKVMKPAKLANGTEISVADFIQIDEWIDIDTRD
NSFKGRSKK