Protein Info for PP_1852 in Pseudomonas putida KT2440

Annotation: putative enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF00106: adh_short" amino acids 10 to 199 (190 residues), 191.2 bits, see alignment E=2.8e-60 PF08659: KR" amino acids 12 to 131 (120 residues), 42 bits, see alignment E=2e-14 PF13561: adh_short_C2" amino acids 19 to 247 (229 residues), 213.9 bits, see alignment E=5.2e-67 PF23441: SDR" amino acids 60 to 199 (140 residues), 29.6 bits, see alignment E=9.3e-11

Best Hits

Swiss-Prot: 53% identical to BDCA_ECOLI: Cyclic-di-GMP-binding biofilm dispersal mediator protein (bdcA) from Escherichia coli (strain K12)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 100% identity to ppu:PP_1852)

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LS6 at UniProt or InterPro

Protein Sequence (249 amino acids)

>PP_1852 putative enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific) (Pseudomonas putida KT2440)
MSKQLTLEGKVALVQGGSRGIGAAIVRRLAREGAQVAFTYVSSAGPAEELAREITENGGK
ALALRADSADAAAVQLAVDDTEKALGRLDILVNNAGVLAVAPVTEFDLADFDHMLAVNVR
SVFVASQAAARYMGQGGRIINIGSTNAERMPFAGGAPYAMSKSALVGLTRGMARDLGPQG
ITVNNVQPGPVDTDMNPASGEFAESLIPLMAIGRYGEPEEIASFVAYLAGPEAGYITGAS
LTVDGGFAA