Protein Info for PP_1842 in Pseudomonas putida KT2440

Annotation: Glutamine amidotransferase, class I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00117: GATase
  • amino acids 79 to 191 (113 residues), 52 bits, E=3.7e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3868)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

See Q88LT5 at UniProt or InterPro

Protein Sequence (244 amino acids)

>PP_1842 Glutamine amidotransferase, class I (Pseudomonas putida KT2440)
MSLRICILETDVLRPELTAQYQGYGRMFEQLFSRQPIAAEFCVYNVMHGDYPADSEKFDA
YLVTGSKADSFGTDPWIQTLKAYLLKLYERGEKLLGVCFGHQLLALTLGGKAERAEQGWG
VGIHRYSLAAHAPWMDPEVSELTLLISHQDQVTELPEGATVIASSDFCPNAAYHIRDQVL
CFQGHPEFVHDYSRALLDARQEYLGDEVYHKAVASLATEHQGDLVGEWMLRFIQQPSKAG
DSAA