Protein Info for PP_1832 in Pseudomonas putida KT2440

Annotation: putative Oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03079: ARD
  • amino acids 91 to 158 (68 residues), 37.3 bits, E=1.6e-13

Best Hits

Swiss-Prot: 45% identical to MTND_PSEF5: Acireductone dioxygenase (mtnD) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K08967, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC: 1.13.11.53 1.13.11.54] (inferred from 100% identity to ppu:PP_1832)

Predicted SEED Role

"1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54)" in subsystem Methionine Salvage (EC 1.13.11.54)

MetaCyc Pathways

• 3-methylthiopropanoate biosynthesis (1/1 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (2/7 steps found)
• L-methionine salvage cycle I (bacteria and plants) (5/12 steps found)
• L-methionine salvage cycle II (plants) (4/11 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.53 or 1.13.11.54

Sequence Analysis Tools

See Q88LU5 at UniProt or InterPro

Protein Sequence (178 amino acids)

>PP_1832 putative Oxidase (Pseudomonas putida KT2440)
MSILSVFHPASPALPNKVLTHHDDIAATLAEQGVRFVHAEPGLRVRPGTAQDEVLEVCRV
YLDELMTAHGSKALALLNRDGEDPAQVDVRDEHVHDADELFAVVSGRAQVGLRLGDWVYS
VLCEKGDQLLVPAGTRRWVELGDTPFCLALRLYGSEQGMQARFTGDVTARAFLGIDEL