Protein Info for PP_1830 in Pseudomonas putida KT2440

Annotation: Chorismate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00033: chorismate synthase" amino acids 10 to 349 (340 residues), 454.5 bits, see alignment E=1.1e-140 PF01264: Chorismate_synt" amino acids 10 to 344 (335 residues), 456.7 bits, see alignment E=1.7e-141

Best Hits

Swiss-Prot: 100% identical to AROC_PSEP1: Chorismate synthase (aroC) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01736, chorismate synthase [EC: 4.2.3.5] (inferred from 100% identity to ppu:PP_1830)

MetaCyc: 72% identical to chorismate synthase (Escherichia coli K-12 substr. MG1655)
Chorismate synthase. [EC: 4.2.3.5]

Predicted SEED Role

"Chorismate synthase (EC 4.2.3.5)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LU7 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PP_1830 Chorismate synthase (Pseudomonas putida KT2440)
MSGNTYGKLFTVTTAGESHGPALVAIVDGCPPGLEISLADLQHDLDRRKPGTSRHTTQRQ
EADEVEILSGVFEGRTTGCSIGLLIRNTDQKSKDYSAIKDLFRPAHADYTYHHKYGIRDY
RGGGRSSARETAMRVAAGAIAKKFLATQGITVRGYMSQLGPIEIPFKTWESVEQNAFFSP
DPDKVPELEAYMDQLRRDQDSVGAKITVVAEGVMPGLGEPIFDRLDAELAHALMSINAVK
GVEIGAGFASVAQRGTEHRDELTPEGFLSNNAGGILGGISSGQPIVAHLALKPTSSITTP
GRSIDVDGNPVDVITKGRHDPCVGIRATPIAEAMMAIALMDHLLRHRAQNADVQVNTPVL
GQR