Protein Info for PP_1827 in Pseudomonas putida KT2440

Annotation: N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 83 to 99 (17 residues), see Phobius details TIGR03533: protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific" amino acids 6 to 287 (282 residues), 419.2 bits, see alignment E=7.9e-130 TIGR00536: methyltransferase, HemK family" amino acids 8 to 291 (284 residues), 256.8 bits, see alignment E=2.1e-80 PF10294: Methyltransf_16" amino acids 124 to 179 (56 residues), 25.1 bits, see alignment E=5.5e-09 PF03602: Cons_hypoth95" amino acids 124 to 207 (84 residues), 26.3 bits, see alignment E=2.1e-09 PF13847: Methyltransf_31" amino acids 127 to 203 (77 residues), 41 bits, see alignment E=6.5e-14 PF05175: MTS" amino acids 127 to 209 (83 residues), 58.4 bits, see alignment E=2.9e-19 PF13649: Methyltransf_25" amino acids 129 to 213 (85 residues), 34.4 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 82% identical to PRMB_PSEAE: 50S ribosomal protein L3 glutamine methyltransferase (prmB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07320, putative adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 99% identity to ppf:Pput_3884)

MetaCyc: 54% identical to ribosomal protein L3 N5-glutamine methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1241 [EC: 2.1.1.298]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.298 or 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LV0 at UniProt or InterPro

Protein Sequence (302 amino acids)

>PP_1827 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase (Pseudomonas putida KT2440)
MITSRLRTLRDYIRWAVSRFHEHDLFFGHGADNAWDEARLLVLGAVHLPWEVADSYLDCM
LEDDERVRLQHLLKRRIEERVPAAYLLGEAWFCGMSFIVDERVLVPRSPIGELIEKRFEP
WLASEPARILDLCTGSGCIGIVAADVFPEAEVVLADLSFQALEVANQNIERHGLDGRVYT
VQGDGFGGLPGQRFDLILSNPPYVDAEDFDDMPAEYHHEPELGLACGSDGLDLVRRMLAE
AADHLTEKGLLIVEVGNSQVHVEALYPEVDFAWLEFERGGHGVFMLTAEQCRQHQELFKA
LV