Protein Info for PP_1804 in Pseudomonas putida KT2440

Annotation: Glycosyl transferase WbpL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 100 to 116 (17 residues), see Phobius details amino acids 122 to 145 (24 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 73 to 225 (153 residues), 126.1 bits, see alignment E=6.5e-41

Best Hits

KEGG orthology group: K13007, Fuc2NAc and GlcNAc transferase [EC: 2.4.1.-] (inferred from 100% identity to ppu:PP_1804)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.7.8.-

Use Curated BLAST to search for 2.4.1.- or 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LX3 at UniProt or InterPro

Protein Sequence (334 amino acids)

>PP_1804 Glycosyl transferase WbpL (Pseudomonas putida KT2440)
MIWLIVLATVASCLMTAVLRRYALSRSLLDIPNARSSHTLPTPRGGGLAFVVAFLAALLG
LGWGGYVAPAVLTSVLGAGGLVALIGFMDDHGHIAARWRLLGHFAAAAWGLAWLGGMPPL
SVFGLLLAPVWLGSAIGLLYLVWLLNLYNFMDGIDGIASIEAICVCMGGSLLYWLTGHAE
AAWLPILLAATVAGFLCWNFPPARIFMGDAGSGFLGIVLGLLALVAGWVNPLLFWGWLIL
SGVFVVDATFTLARRLLRGDKVYQAHRSHAYQYAARRHGHHRPVSLAVAAINLVWLLPVA
LAVVLLNLDGALGTLFAYVPLILLAITYQAGEQE