Protein Info for PP_1803 in Pseudomonas putida KT2440

Annotation: UDP-sugar epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF05368: NmrA" amino acids 4 to 267 (264 residues), 40.6 bits, see alignment E=1e-13 PF04321: RmlD_sub_bind" amino acids 5 to 191 (187 residues), 67.1 bits, see alignment E=5.7e-22 PF02719: Polysacc_synt_2" amino acids 6 to 249 (244 residues), 41.4 bits, see alignment E=4.1e-14 PF01370: Epimerase" amino acids 6 to 228 (223 residues), 115.9 bits, see alignment E=8.3e-37 PF16363: GDP_Man_Dehyd" amino acids 7 to 312 (306 residues), 51.7 bits, see alignment E=3.9e-17 PF01073: 3Beta_HSD" amino acids 7 to 216 (210 residues), 85.3 bits, see alignment E=1.5e-27 PF13460: NAD_binding_10" amino acids 10 to 173 (164 residues), 60.8 bits, see alignment E=6.8e-20 PF07993: NAD_binding_4" amino acids 58 to 193 (136 residues), 56.2 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1803)

MetaCyc: 60% identical to UDP-N-acetyl-alpha-D-quinovosamine dehydrogenase (Pseudomonas aeruginosa)
RXN-14767 [EC: 1.1.1.426]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.426 or 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LX4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>PP_1803 UDP-sugar epimerase (Pseudomonas putida KT2440)
MERRTILVTGASGFVGGALCRQLATLGSFAIRAASRDLGGASVAGIQAVTVADLSATTDW
ARALSGVDLVVHAAARVHVMKETASDSLAEFRRVNVDGTLNLARQAAAAGVRRFIFISSI
KVNGESSQPGQPLRADDSPAPQDAYGVSKHEAEQGLRQLAAATGMEVVVIRPVLVYGPGV
KANFHSMMRWLQRGVPLPFGAVCNRRSLVSLANLVDLVVTCIDHPRAANQTFLASDGDDV
SLTQLLRALGLALGRPARLLPVPAGLLRGAVLLIGRRDLAQRLFGTLQVDIEKNRQLLGW
YPPCTLEQGLNMTARSFLGARRP