Protein Info for PP_1801 in Pseudomonas putida KT2440

Annotation: Glycosyl transferase WbpY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF13439: Glyco_transf_4" amino acids 16 to 174 (159 residues), 47.7 bits, see alignment E=3.7e-16 PF20706: GT4-conflict" amino acids 203 to 314 (112 residues), 41.4 bits, see alignment E=1.9e-14 PF00534: Glycos_transf_1" amino acids 204 to 350 (147 residues), 95.1 bits, see alignment E=7.4e-31 PF13692: Glyco_trans_1_4" amino acids 205 to 339 (135 residues), 81.7 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: K12994, alpha-1,3-rhamnosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to ppu:PP_1801)

MetaCyc: 46% identical to mannosyl-N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 3-alpha-mannosyltransferase (Escherichia coli O8)
RXN-18772 [EC: 2.4.1.349]; 2.4.1.349 [EC: 2.4.1.349]

Predicted SEED Role

"glycosyl transferase, group 1 family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.349

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LX6 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PP_1801 Glycosyl transferase WbpY (Pseudomonas putida KT2440)
MKLILSVESVRFPLTGIGRYTYELASRLQHAEQISDLRLFAGSRFLPELLKPSDQSDAVH
GLKRFVQKNALAVEAYRRLMPLLRKRALRGHEDFIYHSTNFYLPPFAGPRVATFHDLSPF
TWAHCHTPQIARYLQKELKLTLERADALITVSHHTRKELADYFGWPLERIHAVPLASSPQ
FHPRTPQALRETLARHGLELGGYSLFVGTIEPRKNIETLLNAYGRLPLALRQRWPLILSG
YHGWRSEAIHSRIAQAQQEGWARYLGFVASEDLPLLFAGARLFTFPSHYEGFGLPVLEAM
SSGVPVVCSNSSSLPEVAGSAALMCAPDDVEGLTGLLHQGLEDEAWRSAAVQRGLLHAGG
FSWERCAQGTVEVYKSVKER