Protein Info for PP_1781 in Pseudomonas putida KT2440

Annotation: putative O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 180 to 196 (17 residues), see Phobius details amino acids 202 to 219 (18 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 10 to 336 (327 residues), 88.5 bits, see alignment E=2.3e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1781)

Predicted SEED Role

"O-acyltransferase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88LZ5 at UniProt or InterPro

Protein Sequence (362 amino acids)

>PP_1781 putative O-acyltransferase (Pseudomonas putida KT2440)
MPPSTSNRLYTLDVLRGFAALCVVFWHWQHFFYVGSTPAQFDPTLQPLFSQFKMLYQHGG
MAVQLFFTLSGFVFYWLFAAEVADRSLPAARFAWDRFSRLYPLHIVTFMAVAGLQWAYSG
GRDGYFVYPFNDAYHALLNLLMVPAWGLEKGWSFNAPFWSVSVEVLLYAAFFLICLCRRW
KWPLTVMALALGSYLYPEVYKLGSGVLCFFIGGVTYSVLNQLRRWAGDTGTVVATVPLCI
ASWVWLVHRADALNGTVLLYVCYPLLVAALAALGFRWHGLARHWGWLGDISYASYLTHFP
LQILFAIGFDALALPRTVFYQGWVMLLFFSILIPLSLLTHRWLERPAQRYLRQRRQAVPV
AG