Protein Info for PP_1769 in Pseudomonas putida KT2440

Annotation: chorismate mutase/Prephenate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 TIGR01807: chorismate mutase" amino acids 9 to 87 (79 residues), 105.9 bits, see alignment E=5e-35 PF01817: CM_2" amino acids 12 to 95 (84 residues), 78.6 bits, see alignment E=5.2e-26 PF00800: PDT" amino acids 99 to 275 (177 residues), 217.6 bits, see alignment E=1.8e-68 PF01842: ACT" amino acids 285 to 349 (65 residues), 46.9 bits, see alignment E=2.8e-16

Best Hits

Swiss-Prot: 87% identical to CMPDT_PSEAE: Bifunctional chorismate mutase/prephenate dehydratase (pheA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K14170, chorismate mutase / prephenate dehydratase [EC: 4.2.1.51 5.4.99.5] (inferred from 100% identity to ppu:PP_1769)

Predicted SEED Role

"Chorismate mutase I (EC 5.4.99.5) / Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51, EC 5.4.99.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.51 or 5.4.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M06 at UniProt or InterPro

Protein Sequence (367 amino acids)

>PP_1769 chorismate mutase/Prephenate dehydratase (Pseudomonas putida KT2440)
MADMSEQELKALRVRIDSLDEKILELISDRARCAEEVARVKTASLKEGEKPVFYRPEREA
AVLKRVMERNKGPLGNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHA
VISRPMAAIDEVFREVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHH
HLLVGENTKTDSITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAA
IAGDMAANLYGLTRLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSNKPGALHE
LLVPFYQNGIDLTRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLG
SYPKAVL