Protein Info for PP_1769 in Pseudomonas putida KT2440

Annotation: chorismate mutase/Prephenate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01807: chorismate mutase
  • amino acids 9 to 87 (79 residues), 105.9 bits, E=5e-35
• PF01817: CM_2
  • amino acids 13 to 95 (83 residues), 67.8 bits, E=1.4e-22
• PF00800: PDT
  • amino acids 99 to 276 (178 residues), 218.7 bits, E=8.4e-69
• PF01842: ACT
  • amino acids 285 to 349 (65 residues), 47.1 bits, E=2.4e-16

Best Hits

Swiss-Prot: 87% identical to CMPDT_PSEAE: Bifunctional chorismate mutase/prephenate dehydratase (pheA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K14170, chorismate mutase / prephenate dehydratase [EC: 4.2.1.51 5.4.99.5] (inferred from 100% identity to ppu:PP_1769)

Predicted SEED Role

"Chorismate mutase I (EC 5.4.99.5) / Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51, EC 5.4.99.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
• L-tyrosine biosynthesis III (3/4 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• L-phenylalanine biosynthesis II (2/4 steps found)
• L-tyrosine biosynthesis II (2/4 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (2/5 steps found)
• bacilysin biosynthesis (1/10 steps found)
• salinosporamide A biosynthesis (4/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.51 or 5.4.99.5

Sequence Analysis Tools

See Q88M06 at UniProt or InterPro

Protein Sequence (367 amino acids)

>PP_1769 chorismate mutase/Prephenate dehydratase (Pseudomonas putida KT2440)
MADMSEQELKALRVRIDSLDEKILELISDRARCAEEVARVKTASLKEGEKPVFYRPEREA
AVLKRVMERNKGPLGNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHA
VISRPMAAIDEVFREVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHH
HLLVGENTKTDSITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAA
IAGDMAANLYGLTRLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSNKPGALHE
LLVPFYQNGIDLTRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLG
SYPKAVL