Protein Info for PP_1760 in Pseudomonas putida KT2440

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 297 to 323 (27 residues), see Phobius details PF00664: ABC_membrane" amino acids 77 to 327 (251 residues), 95 bits, see alignment E=6.6e-31 PF00005: ABC_tran" amino acids 389 to 537 (149 residues), 110.3 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to ppf:Pput_3954)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M15 at UniProt or InterPro

Protein Sequence (610 amino acids)

>PP_1760 ABC transporter, ATP-binding protein (Pseudomonas putida KT2440)
MLDVPGSPDPVPGKPYTAGDRLSWAEIRRLALHHKKNLWSANLIALLAACCSVPIPLLLP
LLVDEVLLGHGDAALKWMNHLLPSSWQVAAGYIGLMLALTLCLRLAALAFNVIQSKLFAG
LAKDIVYRLRIRLIERLKRISLKEYESLGSGTVTTHLVTDLDTLDKFVGETLSRFLVAML
TLTGTAAILIWMHWQLALLILLFNPLVIYFTVQLGKRVKHLKKLENDSTARFTQALAETL
DAIQEIRAGNRQGYFLGRLGLRAREVRDYAVDSQWKSDASGRASGLLFQFGIDIFRAAAM
LTVLFSDLSIGQMLAVFSYLWFMIGPVEQLLNLQYAYYAAGGALSRLNELLARADEPQYP
AASDPFAGRETVGIEVRDLRFAYADEPVLEHLDLSIAAGEKVAIVGASGGGKSTLVQLLL
GLYSAQAGTIRFGGASLQEIGLETLRENVAVVLQHPSLFNDSVRANLTMGRDCSDDACWQ
ALRIAQLDATIAALPQGLDSVVGRSGVRLSGGQRQRLAIARMVLAEPKVVILDEATSALD
AATEYNLHQALACFLSGRTTLIIAHRLSAVKQADRVLVFDGGHVAEDGDHQQLIAEGGLY
AKLYGHLQQS