Protein Info for PP_1753 in Pseudomonas putida KT2440

Annotation: putative permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 59 (18 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details PF00892: EamA" amino acids 10 to 144 (135 residues), 75.2 bits, see alignment E=3.1e-25 amino acids 161 to 299 (139 residues), 38.9 bits, see alignment E=5e-14

Best Hits

Swiss-Prot: 43% identical to YHBE_ECOLI: Uncharacterized inner membrane transporter YhbE (yhbE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1753)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M22 at UniProt or InterPro

Protein Sequence (324 amino acids)

>PP_1753 putative permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas putida KT2440)
MHTTSGRWGYGLFLALLTALLWGILPIKLKQVLQVVDPITVTWYRLLVSGGLLFAWLAAQ
RRLPSMRKLAPRGKGLVLVAVLGLMGNYVLYLIGLKLLSPGTAQLVVQIGPVLLLVASVF
VFRERFSVGQGMGLLVLLAGFGLFFNQRLEELLTSLGTYTTGVLTILLATSIWVFYALSQ
KQLLTVWHSQQVMMVIYLSCAALLTPWVHPLEALQLTPVQGWLLLACCLNTLVAYGAFAE
ALAHWEASRVSATLALTPLVTFVAVALAAWVWPEYVHAEDINALGYVGAVTVVFGSALVA
LGPSLVTSWRARRERGQRAYSSEG