Protein Info for PP_1741 in Pseudomonas putida KT2440

Annotation: choline / betaine / carnitine ABC transporter - substrate binding protein BetX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF04069: OpuAC" amino acids 30 to 276 (247 residues), 226.9 bits, see alignment E=1.7e-71

Best Hits

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 100% identity to ppf:Pput_3978)

Predicted SEED Role

"Glycine betaine/L-proline ABC transporter, glycine betaine/L-proline- binding/permease protein" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M34 at UniProt or InterPro

Protein Sequence (287 amino acids)

>PP_1741 choline / betaine / carnitine ABC transporter - substrate binding protein BetX (Pseudomonas putida KT2440)
MMATLKKMRRFLGVGTALVMAMSAAQAMAKEVSIGYVDGWADSVATTNVAAEVIKQKLGY
DVKLQAVATGIMWQGVATGKLDAMLSAWLPVTHGEYWAKNKDNVVDYGPNFKDAKIGLIV
PEYVKAVSIADLKTDNSFKDRIVGIDAGSGVMLKTDQAIKDYGLTSYKLQASSGAAMTAE
LGRAYAKQQSIAVTGWVPHWMFAKWKLKFLEDPKGVYGAAETVNSIGSKELATKAPEVAE
FLKKFNWQSKDEIGEVMLAIQEGAKPEAAAKDWVAKHPDRVKEWTGK