Protein Info for PP_1740 in Pseudomonas putida KT2440

Annotation: putative Beta (1-6) glucans synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 329 to 347 (19 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details amino acids 427 to 446 (20 residues), see Phobius details amino acids 452 to 470 (19 residues), see Phobius details amino acids 477 to 494 (18 residues), see Phobius details amino acids 501 to 520 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1740)

Predicted SEED Role

"probable glucosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M35 at UniProt or InterPro

Protein Sequence (525 amino acids)

>PP_1740 putative Beta (1-6) glucans synthase (Pseudomonas putida KT2440)
MCQTMDRHMPSCSRLLLPLYLLACLLALVGLGGLWYGLGKPVHLPDAASPAHKLQCASYT
PFDKDQSPYDQPFRLRPARMDADLALLAERFQCIRTYSMSGLEAIPALARKHGLKVMLGA
WVNAHPADTEKEINLLIAAANANPDVVSAVIVGNETLLRKEVTGAHLAKLIARVKRQVKV
PVTYADVWEFWLQHPQVAPVVDFLTIHLLPYWEDDPRGIDDALAHVADVRRVFGTRFAPK
DILIGETGWPSEGRQRETAVPSRVNEARFIRGFVAMAERNGWHYNLIEAFDQPWKRANEG
AVGGYWGLYDADRQDKGVLEGPVSNLHDWPQWLLASAVLTVIMLVLAGRPATPMAAVLLP
LLAAFGAACLGLWGELMRTHARFAGEWLWALMLAGLNLLVLAHALLALARRAGWRERLFA
WLQVRAGWLLLAAGFAAAVSMLAMVFDPRYRSFPSAALALPALVYVLWPVRARRAEVALL
AFIVGAGVAPQLFVEGLENQQAWGWAVVSVLMTAALWRSLRMRQA