Protein Info for PP_1733 in Pseudomonas putida KT2440

Annotation: membrane ATPase of the MinC-MinD-MinE system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF10609: ParA" amino acids 2 to 244 (243 residues), 48.9 bits, see alignment E=1.8e-16 TIGR01968: septum site-determining protein MinD" amino acids 2 to 268 (267 residues), 397.9 bits, see alignment E=9.8e-124 PF13614: AAA_31" amino acids 3 to 156 (154 residues), 67.5 bits, see alignment E=4.4e-22 PF06564: CBP_BcsQ" amino acids 3 to 148 (146 residues), 27.4 bits, see alignment E=6.9e-10 PF09140: MipZ" amino acids 4 to 142 (139 residues), 32.5 bits, see alignment E=1.8e-11 PF01656: CbiA" amino acids 5 to 226 (222 residues), 62.9 bits, see alignment E=9.2e-21 PF02374: ArsA_ATPase" amino acids 6 to 40 (35 residues), 30.9 bits, see alignment 5e-11

Best Hits

Swiss-Prot: 76% identical to MIND_ECOLI: Septum site-determining protein MinD (minD) from Escherichia coli (strain K12)

KEGG orthology group: K03609, septum site-determining protein MinD (inferred from 99% identity to ppw:PputW619_1283)

Predicted SEED Role

"Septum site-determining protein MinD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M42 at UniProt or InterPro

Protein Sequence (270 amino acids)

>PP_1733 membrane ATPase of the MinC-MinD-MinE system (Pseudomonas putida KT2440)
MAKILVVTSGKGGVGKTTTSAAIGTGLALRGHKTVIVDFDVGLRNLDLIMGCERRVVYDF
VNVVNGEANLQQALIKDKRLENLYVLAASQTRDKDALTQEGVEKVLMDLKKDFEYVICDS
PAGIEKGAHLAMYFADEAIVVTNPEVSSVRDSDRMLGILSSKSRRSENGEEPIKEHLLIT
RYHPERVVKGEMLSVADVEEILSIKLKGVIPESQAVLKASNQGIPVILDDQSDAGQAYSD
AVDRLLGKEKPMRFIDVQKKGFFERIFGSK