Protein Info for PP_1728 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 133 to 154 (22 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 283 to 306 (24 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 406 to 429 (24 residues), see Phobius details amino acids 449 to 471 (23 residues), see Phobius details amino acids 495 to 514 (20 residues), see Phobius details amino acids 521 to 549 (29 residues), see Phobius details PF21088: MS_channel_1st" amino acids 498 to 536 (39 residues), 36.5 bits, see alignment 5.9e-13 PF00924: MS_channel_2nd" amino acids 538 to 602 (65 residues), 60 bits, see alignment E=2.9e-20 PF21082: MS_channel_3rd" amino acids 609 to 694 (86 residues), 23.9 bits, see alignment E=6.7e-09

Best Hits

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 100% identity to ppu:PP_1728)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M46 at UniProt or InterPro

Protein Sequence (717 amino acids)

>PP_1728 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MPVPALLRYLFLLLLLFIAPVQAAGLPGLLGGSAPAQPEATEPLGKSLDEVIKNLENDQQ
RAKLLADLKKLRDATRQSQPSVEQGVLGLIGGALHDFEKQFSGDASPFHRWAAEIEQAQA
ELAELVVPVHQWPAILFGFAAVIAVWSVLAYAFNWVGHRVRLRFGLSEELPQHPRTWDLV
RFALRKLGPWLVALVFTVYLSFVLPPSLGKSLAMVLAYALVVGTCFSAICVIAFSLLDGP
HRHRALHILRRQAFRPLWLIGSFAAFGEAMSDPRMLVALGTHLAHTLATLANVIAALCTG
LFILRFRRPIAHLIRNQPLSRRLTRRTLSDTIEILGSFWFIPALILVAISLFATFVSAGD
TSTALRQSLMCTVLVVVCMVLNGLVRRHAANPKRASKRQAVYTERLRNFGYLLVHLFIWL
VFIELGLRVWGVSMISFAEGDGHDISLRLLGLAGTLIVAWLVWILADTAVHHALVRSRRG
LANARAQTMMPLIRNVMFVVIFIIAVIVALANMGMNVTPLLAGAGVIGLAIGFGAQSLVA
DLITGLFIIIEDSLAIDDYVDVGGHLGTVEGLTIRTVRLRDIDGIVHTIPFSEIKSIKNY
SREFGYAIFRVAIPHSMNIDQAISLVREVGQKLRNDPLMRRNIWSPLELQGVESFESGSA
ILRARFKTAPIKQWEVSRAFNLALKRQLDEAGLDLATPRLSVQVVTAGGGGMTEAGS