Protein Info for PP_1727 in Pseudomonas putida KT2440

Annotation: Transcriptional regulator, GntR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00392: GntR" amino acids 11 to 71 (61 residues), 62.1 bits, see alignment E=3.1e-21 PF07702: UTRA" amino acids 93 to 230 (138 residues), 135.5 bits, see alignment E=1.2e-43

Best Hits

Swiss-Prot: 48% identical to PHNR_SALCH: Putative transcriptional regulator of 2-aminoethylphosphonate degradation operons (phnR) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3992)

Predicted SEED Role

"2-aminoethylphosphonate uptake and metabolism regulator" in subsystem Phosphonate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M47 at UniProt or InterPro

Protein Sequence (237 amino acids)

>PP_1727 Transcriptional regulator, GntR family (Pseudomonas putida KT2440)
MQSTPPRAVTAICHALQEQIEHGLLAPGGKLPAERRLSEVFDTTRITLREALVQLEAQGL
IYREERRGWFVAPQRLTYDLIERSHFHAMVRDQGRVASTELLSARLQPASAAICARLQLP
ALSSVVRVCRLRRIDGRAVLYAEHYLNPRYFPGILEHDLAQSLTEIYGRVYGIEYGQVCF
EILPTALPVEAASALKVSAGSPGLHITRVNSDQHGHLIDCDLEYWRHDAIRIRAQAG