Protein Info for PP_1727 in Pseudomonas putida KT2440
Annotation: Transcriptional regulator, GntR family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 48% identical to PHNR_SALCH: Putative transcriptional regulator of 2-aminoethylphosphonate degradation operons (phnR) from Salmonella choleraesuis (strain SC-B67)
KEGG orthology group: None (inferred from 100% identity to ppf:Pput_3992)Predicted SEED Role
"2-aminoethylphosphonate uptake and metabolism regulator" in subsystem Phosphonate metabolism
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88M47 at UniProt or InterPro
Protein Sequence (237 amino acids)
>PP_1727 Transcriptional regulator, GntR family (Pseudomonas putida KT2440) MQSTPPRAVTAICHALQEQIEHGLLAPGGKLPAERRLSEVFDTTRITLREALVQLEAQGL IYREERRGWFVAPQRLTYDLIERSHFHAMVRDQGRVASTELLSARLQPASAAICARLQLP ALSSVVRVCRLRRIDGRAVLYAEHYLNPRYFPGILEHDLAQSLTEIYGRVYGIEYGQVCF EILPTALPVEAASALKVSAGSPGLHITRVNSDQHGHLIDCDLEYWRHDAIRIRAQAG