Protein Info for PP_1724 in Pseudomonas putida KT2440

Annotation: putative ABC-type 2-aminoethylphosphonate transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 195 to 220 (26 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 274 (199 residues), 44.4 bits, see alignment E=8.1e-16

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to ppu:PP_1724)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M50 at UniProt or InterPro

Protein Sequence (279 amino acids)

>PP_1724 putative ABC-type 2-aminoethylphosphonate transporter permease (Pseudomonas putida KT2440)
MNGGIRGRYLALLCLLPFAVFFVIFQVAPLAWVAINSLQSEAGWGIDNFSKVFASKFYRQ
ALQRSLEISFWSSVFGIVIATLGAYSLRQVDSKLRDFVSAFANMTSNFAGVPLAFAFIIL
LGFNGALTLLLKQVGLLEDFSIYSKSGLILVYTYFQIPLGVLLLYPAFDALREDWRESAA
LLGANHWQFWRHIGLPVLAPALLGTFVILLANALGAYATVYALTTGNFNVLPIRIAGLVA
GDISLDPNLASALAMVLVGLMTLVTVVHQWLLKRSYHAR