Protein Info for PP_1723 in Pseudomonas putida KT2440

Annotation: putative 2-aminoethylphosphonate transport system permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 64 to 91 (28 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 93 to 261 (169 residues), 49.5 bits, see alignment E=2.2e-17

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to ppu:PP_1723)

Predicted SEED Role

"Thiamin ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M51 at UniProt or InterPro

Protein Sequence (264 amino acids)

>PP_1723 putative 2-aminoethylphosphonate transport system permease (Pseudomonas putida KT2440)
MRADIRSGGWYHRLVVYLLFLILLLPLAGTLLYSLATSWSASLLPSGLTLKWYAALWSEP
RFLAAFGQSLLVCVGALLLSVVLILPLLFVVHYHFPRLDALMNILILLPFAVPPVVSSVG
LLQLYGSGPMAMVGTPWILIGCYFTIALPFMYRAITNNLQAINLRDLMDAAQLLGASTWQ
AALLVVLPNLRQGLMVAVLLSFSFLFGEFVFANLLVGTRYETLQVYLNNMRNSSGHFNSA
LVISYFAFVLVLTWVANRLNKDKT