Protein Info for PP_1714 in Pseudomonas putida KT2440

Annotation: FKBP-type peptidyl-prolyl cis-trans isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01346: FKBP_N" amino acids 34 to 131 (98 residues), 96.9 bits, see alignment E=1.1e-31 PF00254: FKBP_C" amino acids 138 to 226 (89 residues), 100.1 bits, see alignment E=7.1e-33

Best Hits

Swiss-Prot: 39% identical to FKBA_NEIMB: Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA (fkpA) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K03773, FKBP-type peptidyl-prolyl cis-trans isomerase FklB [EC: 5.2.1.8] (inferred from 100% identity to ppf:Pput_4005)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FklB (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M60 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PP_1714 FKBP-type peptidyl-prolyl cis-trans isomerase (Pseudomonas putida KT2440)
MKQHRLAAAVALVGLVLAGCDQQASSPELKTPAQKASYGIGLNMGKSLAQEGMEDLDSKA
VALGIEDAVSKKEQRIKDEELVEAFTALQKRAEERLAKASEEAASAGKKFLEENAKKPGV
VTTASGLQYEVVKKADGPQPKPTDVVTVHYEGKLIDGKVFDSSVERGSPIDLPVSGVIPG
WVEGLQLMHVGEKYKLFIPAELAYGAQSPSPLIPANSVLVFDLELIAIKDPAQLQGAEPQ
AEAPEEAPAK