Protein Info for PP_1694 in Pseudomonas putida KT2440

Annotation: DNA recombination limiting inversions protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 340 to 360 (21 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details PF02646: RmuC" amino acids 174 to 466 (293 residues), 344.4 bits, see alignment E=2.5e-107

Best Hits

Swiss-Prot: 78% identical to RMUC_PSEAE: DNA recombination protein RmuC homolog (rmuC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 100% identity to ppu:PP_1694)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M80 at UniProt or InterPro

Protein Sequence (495 amino acids)

>PP_1694 DNA recombination limiting inversions protein (Pseudomonas putida KT2440)
MTVDLASILLGLVAGAIPCLVWVMQVQRRQGARQAEQALLEERLNAAQLAQAGLQAQLDA
SRDEVSDLSEANAVKQAQLAAQSRELELLQIDRDNARDAAHAWSLERANREAELRRLEAQ
TARLDAELREQQESHQQRLEDLQEARDTLRAQFADMATKIFDEREQRFAQTSQQHLGQLL
DPLKERIQAFEKRVEESYQQEARERFSLGKELERLQQLNLRLSDEATNLTQALKGQKTQG
NWGELILERVLEHAGLEKGREYQTQVSLKSADGERFQPDVLIMLPGDKQVVVDAKVSLTA
YQQFVAGNDEVALKQHVQSLRSHVKGLSSKDYSRLEGLHSLDFVLLFVPIEAAFSAALQA
EPNLFQEAFDRQIVIVSPTTLLATLRVIDSLWKQERQGQNAREIAERAGWLYDKFVLFIQ
DLDELGSRLQQVDKAYAAARNKLCEGRGNLVSRSEQLKLLGARASKSLPADLLERALSDE
ALPEVAVTEPGSDGD