Protein Info for PP_1681 in Pseudomonas putida KT2440

Annotation: cobalamin 5'-phosphate synthase / Cobalamin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to COBS_PSEPK: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 100% identity to ppu:PP_1681)

Predicted SEED Role

"Cobalamin synthase (EC 2.7.8.26)" (EC 2.7.8.26)

MetaCyc Pathways

adenosylcobalamin biosynthesis II (aerobic) (31/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
2-methyladeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-hydroxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-methoxy-6-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-methoxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
5-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
adeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
adenosylcobalamin biosynthesis from adenosylcobinamide-GDP I (3/3 steps found)
benzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
4-methylphenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
phenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
adenosylcobalamin biosynthesis from adenosylcobinamide-GDP II (2/4 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M93 at UniProt or InterPro

Protein Sequence (251 amino acids)

>PP_1681 cobalamin 5'-phosphate synthase / Cobalamin synthase (Pseudomonas putida KT2440)
MAMGNWSRRPEMLPFWIALQFLSSLPVSLPGMPAPREVGRSLLYYPLVGLLFGLLLWLAS
HLLQGTPSPLHAALLLTLWVLLSGALHLDGLADSADAWLGGFGDRERTLRIMKDPRSGPI
AVVTLVLVLLLKFCALWVLVGQGIGAQLLLAPLIGRAAMLGLFLCTPYVRPGGLGQALAE
HMPRRAAGWVLLVCVLFCLFLGGWSVLLALAVFAWLRHLMCRRLGGTTGDTAGALLELLE
LAVVLGLALGL