Protein Info for PP_1677 in Pseudomonas putida KT2440

Annotation: Adenosyl-cobyric acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF13500: AAA_26" amino acids 3 to 230 (228 residues), 68.4 bits, see alignment E=1.2e-22 PF01656: CbiA" amino acids 4 to 235 (232 residues), 81.8 bits, see alignment E=6.2e-27 TIGR00313: cobyric acid synthase CobQ" amino acids 4 to 474 (471 residues), 483.5 bits, see alignment E=3.5e-149 PF07685: GATase_3" amino acids 250 to 433 (184 residues), 198.6 bits, see alignment E=1.3e-62

Best Hits

Swiss-Prot: 100% identical to COBQ_PSEPK: Cobyric acid synthase (cobQ) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 100% identity to ppu:PP_1677)

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88M97 at UniProt or InterPro

Protein Sequence (484 amino acids)

>PP_1677 Adenosyl-cobyric acid synthase (Pseudomonas putida KT2440)
MTTLMVQGTTSDAGKSTLVTALCRWLLRQGVAVVPFKPQNMALNSAVTADGGEIGRAQAV
QAQACRLQPHTDMNPVLLKPNSDTGAQVIIHGRAVTSMNAVAYHDYKTTAMQAVLASHHR
LSAAYPVVMVEGAGSPAEINLRAGDIANMGFAEAVDCPVILVADINRGGVFAHLVGTLEL
LSTTEQARVKGFVINRFRGDIALLQPGLDWLEQRTGKPVLGVLPYVTDLHLEAEDGIDVR
QGVKHERVLKVIVPVLPRISNHTDFDPLRLHPQVDLQFIGPGQPIPAADLIILPGSKSVR
GDLAQLRERGWDKAIERHLRYGGKLIGICGGLQMLGREVHDPLGLEGAAGSSQGLGLLDY
ATVLEAEKQLRNVAGTLSLEAATVTGYEIHAGVTTGPALAQPAVQLADGRHDGAVSADGQ
ILATYLHGLFEGSQSCAALLRWAGLEDVQVIDYEALREHDIERLADLVEKHLDTVQLRQL
CGVA