Protein Info for PP_1655 in Pseudomonas putida KT2440

Annotation: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 25 to 78 (54 residues), 33.3 bits, 1.3e-11
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 274 to 444 (171 residues), 209.7 bits, E=3.6e-66
• PF05958: tRNA_U5-meth_tr
  • amino acids 281 to 448 (168 residues), 89.1 bits, E=1.1e-28
• PF03602: Cons_hypoth95
  • amino acids 300 to 389 (90 residues), 27.4 bits, E=9.1e-10
• PF05175: MTS
  • amino acids 301 to 385 (85 residues), 26.1 bits, E=2.2e-09
• PF13847: Methyltransf_31
  • amino acids 306 to 383 (78 residues), 33.6 bits, E=1.1e-11
• PF13649: Methyltransf_25
  • amino acids 310 to 365 (56 residues), 35.2 bits, 5.9e-12
• PF08241: Methyltransf_11
  • amino acids 311 to 366 (56 residues), 22.6 bits, 4.8e-08

Best Hits

Swiss-Prot: 100% identical to RLMD_PSEPK: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to ppf:Pput_4063)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q88MB9 at UniProt or InterPro

Protein Sequence (452 amino acids)

>PP_1655 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (Pseudomonas putida KT2440)
MSKKKSNSGLRFQPAGGNRTPQVPVGKKQRLDIERLAGDGRGIAFLDGRTWFVSGALAGE
AVEARVLNARGKVVEARLERLLQAAPERREAPCRYYDRCGGCNLQHLPHEAQLALKQRTL
AEQLQRVAGVQPEAWAAPLSGPEFGYRRRARVAVRWDVKARQLEVGFRAEASQDIIAIDD
CAVLVQPLQSILRHLPTVLRSLSKPQALGHVELFSGTAEAVLVRHVAPLPAEDQARLQAF
CEQANAQLWLQGEGEPAPVDPAAQLGFALAPWQLELAWRPGDFVQVNAQVNTAMIEQALA
WLAPQADERVLDLFCGLGNFALPLARQAREVVAVEGVQAMVDRAAANARNNNVHNARFFQ
ADLSQPLAGTGWAAEGFSAVLLDPPRDGAFEVVQGIARLKARRLVYVSCNPATLARDAQV
LVGQGYRLKRAGILDMFPQTAHVEAMALFEAG