Protein Info for PP_1649 in Pseudomonas putida KT2440

Annotation: D-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF00389: 2-Hacid_dh" amino acids 17 to 340 (324 residues), 106.2 bits, see alignment E=1.6e-34 PF02826: 2-Hacid_dh_C" amino acids 123 to 310 (188 residues), 194.5 bits, see alignment E=1.5e-61 PF03446: NAD_binding_2" amino acids 159 to 270 (112 residues), 24.4 bits, see alignment E=4.1e-09

Best Hits

Swiss-Prot: 52% identical to LDHD_ECOLI: D-lactate dehydrogenase (ldhA) from Escherichia coli (strain K12)

KEGG orthology group: K03778, D-lactate dehydrogenase [EC: 1.1.1.28] (inferred from 100% identity to ppu:PP_1649)

MetaCyc: 52% identical to D-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
D-lactate dehydrogenase. [EC: 1.1.1.28]

Predicted SEED Role

"D-lactate dehydrogenase (EC 1.1.1.28)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.28)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MC4 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PP_1649 D-lactate dehydrogenase (Pseudomonas putida KT2440)
MTHPRHALQRSSTMRALLFSSQHYDQESFTKAAGGTALELHFQPARLTLDTAALADGFEV
VCAFINDELDAPVLQRLAAAGTRLIALRSAGYNHVDLAAAQRLGLAVVRVPAYSPHAVAE
HAVALILALNRRLHRAYNRTREGDFTLHGLTGFDLHGKTVGVVGTGQIGVAFARIMAGFG
CQLLAYDPYPNPELLALGARYLPLPELLREARIISLHCPLTEHTRHLINAQSLAQLQPGA
MLINTGRGALVDTPALIDALKSGQLGYLGLDVYEEEAQLFFEDRSDLPLQDDVLARLLTF
PNVIITAHQAFLTREALDAIAATTLDNINRWAAGNPQNLVMG