Protein Info for PP_1640 in Pseudomonas putida KT2440

Annotation: putative inner membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 69 to 95 (27 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 164 to 191 (28 residues), see Phobius details PF04893: Yip1" amino acids 7 to 181 (175 residues), 153.7 bits, see alignment E=2.4e-49

Best Hits

Swiss-Prot: 55% identical to YOHC_ECOLI: Inner membrane protein YohC (yohC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to ppw:PputW619_1202)

Predicted SEED Role

"probable membrane protein YPO2362"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MD3 at UniProt or InterPro

Protein Sequence (199 amino acids)

>PP_1640 putative inner membrane protein of unknown function (Pseudomonas putida KT2440)
MIHHVVGLFTHPDQEWREIRGEEETISHMYLTHTLILAAIPAVSAFIGTTQVGWVIGDRP
AVMLTMESAIWMSIMSYLAMLAGVAVMGAFIHWMARTYDANPSMAQCIAFATYTATPLFI
GGLAALYPHLWLGMLIGTAAICYTVYLLYVGLPTFMNIPSDEGFLFSSSVLAVGLVVLVA
IMAATVIIWGLGVGPVYTN