Protein Info for PP_1626 in Pseudomonas putida KT2440

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 857 transmembrane" amino acids 628 to 643 (16 residues), see Phobius details TIGR01070: DNA mismatch repair protein MutS" amino acids 7 to 854 (848 residues), 1286.5 bits, see alignment E=0 PF01624: MutS_I" amino acids 8 to 119 (112 residues), 148.1 bits, see alignment E=2.9e-47 PF05188: MutS_II" amino acids 128 to 253 (126 residues), 114.2 bits, see alignment E=1.5e-36 PF05192: MutS_III" amino acids 269 to 558 (290 residues), 164.4 bits, see alignment E=1.1e-51 PF05190: MutS_IV" amino acids 427 to 517 (91 residues), 96.5 bits, see alignment E=2.4e-31 PF00488: MutS_V" amino acids 609 to 795 (187 residues), 283.9 bits, see alignment E=1.8e-88

Best Hits

Swiss-Prot: 100% identical to MUTS_PSEPK: DNA mismatch repair protein MutS (mutS) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 100% identity to ppu:PP_1626)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ME7 at UniProt or InterPro

Protein Sequence (857 amino acids)

>PP_1626 DNA mismatch repair protein MutS (Pseudomonas putida KT2440)
MSDLSAHTPMMQQYWKLKNQHPDQLMFYRMGDFYEIFYEDAKKAAKLLDITLTARGQSAG
QSIPMCGIPFHSLEGYLAKLVKLGESVVICEQIGDPATSKGPVERQVVRIITPGTVSDEA
LLDERRDNLIAALLGDERLFGLAVLDITSGNFSVQEIKGWENLLAELERLNPVELLIPDD
WPRDLPAEKRPGARRRAPWDFDRDSARKALCQQFATKDLKGFGCDKLTLAIGAAGCLLTY
AKETQRTALPHLRSLRHERLDDTVILDGASRRNLELDINLAGGRDNTLQSVIDRCQTAMA
SRLLSRWLNRPLRDLKVLQARQDSIRCLLDSYRFEKLQPQLKEIGDIERILARIGLRNAR
PRDLARLRDALGALPELQNAMTELEAPHLARLAAITGTYPELASLLERAIIDNPPAVIRD
GGVLKAGYDNELDELLAISENAGQFLIDLEAREKARTGLANLKVGYNRVHGYFIELPTKQ
AEQAPGDYIRRQTLKGAERFITPELKAFEDKALSAKSRALAREKMLYDALLETLISHLAP
LQDSAAALAELDVLSNLAERALNLDLNCPRFVDEPCLRIEQGRHPVVEQVLTTPFVANDL
GLDNSTRMLIITGPNMGGKSTYMRQTALIVLLAHIGSFVPAASCELSLVDRIFTRIGSSD
DLAGGRSTFMVEMSETANILHNATDRSLVLMDEVGRGTSTFDGLSLAWAAAERLAQLRAY
TLFATHYFELTVLPESEPLVANVHLNATEHNERIVFLHHVLPGPASQSYGLAVAQLAGVP
TAVIQRAREHLGRLETTSLPHEQPAAHKAKDAPQVPHQSDLFASLPHPAIEKLGKLQLDD
MTPRQAIEMLYQLKNLL