Protein Info for PP_1616 in Pseudomonas putida KT2440

Annotation: formaldehyde dehydrogenase, glutathione-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 166 to 184 (19 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details TIGR02818: S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase" amino acids 4 to 371 (368 residues), 728.3 bits, see alignment E=8.5e-224 PF08240: ADH_N" amino acids 29 to 158 (130 residues), 78.8 bits, see alignment E=5.3e-26 PF00107: ADH_zinc_N" amino acids 199 to 331 (133 residues), 87.2 bits, see alignment E=1.4e-28 PF13602: ADH_zinc_N_2" amino acids 232 to 364 (133 residues), 27.8 bits, see alignment E=6.3e-10

Best Hits

Swiss-Prot: 74% identical to FRMA_SYNY3: S-(hydroxymethyl)glutathione dehydrogenase (frmA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00121, S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC: 1.1.1.1 1.1.1.284] (inferred from 100% identity to ppg:PputGB1_1170)

MetaCyc: 72% identical to S-(hydroxymethyl)glutathione dehydrogenase (Escherichia coli K-12 substr. MG1655)
S-(hydroxymethyl)glutathione dehydrogenase. [EC: 1.1.1.284]

Predicted SEED Role

"S-(hydroxymethyl)glutathione dehydrogenase (EC 1.1.1.284)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 1.1.1.284)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.284

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MF5 at UniProt or InterPro

Protein Sequence (371 amino acids)

>PP_1616 formaldehyde dehydrogenase, glutathione-dependent (Pseudomonas putida KT2440)
MMIKSRAAVAFEAKKPLEIVEVDVAMPKAGEVLLRVVASGVCHTDAYTLSGADPEGIFPS
ILGHEGGAIVEAVGEGVTSLAVGDHVIPLYTPECGKCKFCLSGKTNLCQAIRATQGKGLM
PDGTTRFSYKGQQLFHYMGTSTFSEYTVLPEISVAKIQKEAPLEKVCLLGCGVTTGIGAV
LNTAKVKPGDTVAIFGLGGIGLSAVIGAVKAKASRIIAIDINPAKFEIARQLGATDCVNP
KDYDRPIQEVIVDLTDGGVDFSFECIGNVQLMRAALECCHKGWGESVIIGVAGAGQEIST
RPFQLVTGRVWRGSAFGGVRGRSELPSYVEMSEKGEIPLDTFITHTMGLEDINKAFDLMH
EGKSIRSVIHF