Protein Info for PP_1610 in Pseudomonas putida KT2440

Annotation: CTP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00337: CTP synthase
  • amino acids 2 to 534 (533 residues), 844.6 bits, E=1.5e-258
• PF06418: CTP_synth_N
  • amino acids 3 to 265 (263 residues), 424.2 bits, E=3e-131
• PF00117: GATase
  • amino acids 300 to 533 (234 residues), 149.8 bits, E=1.2e-47
• PF07722: Peptidase_C26
  • amino acids 362 to 516 (155 residues), 30.3 bits, E=5.5e-11

Best Hits

Swiss-Prot: 100% identical to PYRG_PSEP1: CTP synthase (pyrG) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 100% identity to ppu:PP_1610)

MetaCyc: 71% identical to CTP synthetase (Escherichia coli K-12 substr. MG1655)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

See Q88MG1 at UniProt or InterPro

Protein Sequence (542 amino acids)

>PP_1610 CTP synthase (Pseudomonas putida KT2440)
MTRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVF
VTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRIYEHVLRKERRGDYLGATIQVIPHITD
EIKRRIIKGAGDADVALVEIGGTVGDIESQPFLEAIRQLRVEVGSKRAMLMHLTLVPYIA
TAGETKTKPTQHSVKELRSIGLQPDVLICRSDHPVDASSRRKIALFTNVEERAVISLEDV
DTIYKIPGVLHAQGLDDFVVERFGLQCNGADLSEWDKVVDAKLNPEHEVTIAMVGKYMEL
LDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTSLLEGADAILVPGGFGLRGVEGK
ITAVQYARENKVPYLGICLGMQVAVIEFARNVMGWKDANSTEFDRNSGHPVVGLITEWAD
ATGAVETRDEASDLGGTMRLGAQDCQLAAGSKVHDCYGKDVITERHRHRYEVNNNLLPQL
VEAGLVVSGRSEDGALVEVVESKDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAALAQKN
KA