Protein Info for PP_1610 in Pseudomonas putida KT2440

Annotation: CTP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00337: CTP synthase" amino acids 2 to 534 (533 residues), 844.6 bits, see alignment E=1.5e-258 PF06418: CTP_synth_N" amino acids 3 to 265 (263 residues), 422.5 bits, see alignment E=9.9e-131 PF00117: GATase" amino acids 300 to 533 (234 residues), 148 bits, see alignment E=3.9e-47 PF07722: Peptidase_C26" amino acids 362 to 516 (155 residues), 30.3 bits, see alignment E=5.5e-11

Best Hits

Swiss-Prot: 100% identical to PYRG_PSEP1: CTP synthase (pyrG) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 100% identity to ppu:PP_1610)

MetaCyc: 71% identical to CTP synthetase (Escherichia coli K-12 substr. MG1655)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MG1 at UniProt or InterPro

Protein Sequence (542 amino acids)

>PP_1610 CTP synthase (Pseudomonas putida KT2440)
MTRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVF
VTHDGAETDLDLGHYERFIRTTMTQNNNFTTGRIYEHVLRKERRGDYLGATIQVIPHITD
EIKRRIIKGAGDADVALVEIGGTVGDIESQPFLEAIRQLRVEVGSKRAMLMHLTLVPYIA
TAGETKTKPTQHSVKELRSIGLQPDVLICRSDHPVDASSRRKIALFTNVEERAVISLEDV
DTIYKIPGVLHAQGLDDFVVERFGLQCNGADLSEWDKVVDAKLNPEHEVTIAMVGKYMEL
LDAYKSLIEAMSHAGITNRTKVNLRYIDSEDIENQGTSLLEGADAILVPGGFGLRGVEGK
ITAVQYARENKVPYLGICLGMQVAVIEFARNVMGWKDANSTEFDRNSGHPVVGLITEWAD
ATGAVETRDEASDLGGTMRLGAQDCQLAAGSKVHDCYGKDVITERHRHRYEVNNNLLPQL
VEAGLVVSGRSEDGALVEVVESKDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAALAQKN
KA