Protein Info for PP_1608 in Pseudomonas putida KT2440

Annotation: tRNA(Ile)-lysidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF01171: ATP_bind_3" amino acids 13 to 189 (177 residues), 183.4 bits, see alignment E=5.5e-58 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 14 to 193 (180 residues), 168.7 bits, see alignment E=1.4e-53 PF09179: TilS" amino acids 245 to 310 (66 residues), 56.2 bits, see alignment E=5e-19 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 352 to 396 (45 residues), 44.8 bits, see alignment 6.5e-16 PF11734: TilS_C" amino acids 352 to 406 (55 residues), 51.4 bits, see alignment 8.5e-18

Best Hits

Swiss-Prot: 100% identical to TILS_PSEPK: tRNA(Ile)-lysidine synthase (tilS) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 100% identity to ppu:PP_1608)

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MG3 at UniProt or InterPro

Protein Sequence (427 amino acids)

>PP_1608 tRNA(Ile)-lysidine synthase (Pseudomonas putida KT2440)
MINLTPWLNAPTWYVAFSGGLDSTVLLHLLAEYARNHASPPLRAIHIHHGLQAAADAWPA
HCQAICDNFDVELQVIHVQVSPGASLEQAARDARYAAFRQVLGPGDILFTGQHRDDQAET
LLFRLLRGAGLRGLAAMPGQRALGQGSLVRPLLACSRQHLQEYAQAQGLTWIEDPSNVDT
QFARNYLRGEVMPHLQQRWPQASQNFARAAEHLGEALGLLDELAQEDLALAGKGAPLAWP
GLDSLDLAALLALSPARQRNALQYWLSQRTRLPDTRHWAGWADLRDAGADARPVWRLADG
RLVRSHGRIWWLSGDWLQQPAGSLAWPDPDGPLRLPGNGCVRLVGAAVPSGLRIAYRQGG
EMLEVPGRGRRDLKRLLNEQQVPHFLRSRLPLLYHGECLLAVANLPGLVQADCQLHWQLP
TNAQGLS