Protein Info for PP_1603 in Pseudomonas putida KT2440

Annotation: Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase
  • amino acids 4 to 256 (253 residues), 313.2 bits, E=5.7e-98
• PF00132: Hexapep
  • amino acids 14 to 48 (35 residues), 36.8 bits, 2.1e-13
  • amino acids 105 to 137 (33 residues), 33 bits, 3.5e-12
• PF13720: Acetyltransf_11
  • amino acids 176 to 256 (81 residues), 87.1 bits, E=8.3e-29

Best Hits

Swiss-Prot: 100% identical to LPXA_PSEP1: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 99% identity to ppg:PputGB1_1158)

MetaCyc: 51% identical to acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Vibrio cholerae O1 biovar El Tor str. N16961)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (16/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

See Q88MG8 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PP_1603 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase (Pseudomonas putida KT2440)
MNSIDPRAIIDPSAKLADGVEVGPWSIVGPDVEIGEGTVIGPHVVLKGPTRIGKHNRIFQ
FSSIGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTVQDRAETTVGDHNLIMAYAHIG
HDSVIGNHCILVNNTALAGHVHVGDWAILSGYTLVHQYCHIGAHAFSGMGTAIGKDVPAF
VTVFGSPAEARSMNFEGMRRRGFSDEVIHVLRRCYKIVYRQGLTVEDALKELAEPATQHP
EVELFRQSILSSARGITR