Protein Info for PP_1598 in Pseudomonas putida KT2440

Annotation: regulatory intramembrane protein RIP zinc protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 384 to 413 (30 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 6 to 452 (447 residues), 406.4 bits, see alignment E=7.1e-126 PF02163: Peptidase_M50" amino acids 12 to 438 (427 residues), 255.4 bits, see alignment E=9.9e-80 PF17820: PDZ_6" amino acids 131 to 163 (33 residues), 27.9 bits, see alignment (E = 4.1e-10) amino acids 229 to 280 (52 residues), 34.7 bits, see alignment 3e-12 PF13180: PDZ_2" amino acids 227 to 291 (65 residues), 34.3 bits, see alignment E=6.1e-12

Best Hits

Swiss-Prot: 78% identical to Y3649_PSEAE: Putative zinc metalloprotease PA3649 (PA3649) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 100% identity to ppu:PP_1598)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MH3 at UniProt or InterPro

Protein Sequence (452 amino acids)

>PP_1598 regulatory intramembrane protein RIP zinc protease (Pseudomonas putida KT2440)
MDMTALYMIIGTLVALGVLVTFHEFGHFWVARRCGVKVLRFSVGFGTPLLRWHDRHGTEF
VVAAIPLGGYVKMLDEREGDVPPALAGQSFNRKSVRQRIAIVAAGPIANFLLAILFFWVL
AMLGTQQIRPVIGAVDSGSLAASAGLTAGQEIVSVDGKPTNGWSAVNLQLVRRLGESGTL
QIGVRDEGASAERQLQVKLDSWLKGADEPDPIQSLGLRPWRPAITPVLAEIDPKGPAAAA
GLKTGDKLLALDDLAVTEWQQVVDRVRARPDAKVVVRVERDGAALELPVTLARKGEGKAV
GGYLGAGVKGGEWPANMLREISYGPLDAVGESLSRTWNMSVLTLESLKKMLFGELSVKNL
SGPITIAKVAGASAQSGVGDFLNFLAYLSISLGVLNLLPIPVLDGGHLLFYLVEWARGRP
LSDRVQGWGVQIGISLVIGVMLLALINDLGRL