Protein Info for PP_1596 in Pseudomonas putida KT2440
Annotation: CTP:phosphatidate cytidyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 74% identical to CDSA_PSEAE: Phosphatidate cytidylyltransferase (cdsA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to ppf:Pput_4181)Predicted SEED Role
"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)
MetaCyc Pathways
- phosphatidylglycerol biosynthesis I (6/6 steps found)
- phosphatidylglycerol biosynthesis II (6/6 steps found)
- superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
- CDP-diacylglycerol biosynthesis I (4/4 steps found)
- CDP-diacylglycerol biosynthesis II (4/4 steps found)
- superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
- CDP-diacylglycerol biosynthesis III (3/5 steps found)
- type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
- superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.7.41
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88MH5 at UniProt or InterPro
Protein Sequence (271 amino acids)
>PP_1596 CTP:phosphatidate cytidyltransferase (Pseudomonas putida KT2440) MLKQRIITALILLPVALGGFFLLNGGDFALFIGFVVTLGAWEWARLAGLMAQPLRIAYAA VVAGALMLLHILPELAPWVLGAAVIWWGLATWLVLTYPRSSDLWASAACRLLIGLLVLLP AWQGLVLLKHWPLGNWLILSVMVLVWAADIGAYFSGRAFGKRKLAPQVSPGKSWEGVYGG LAVSLLITLGVGISRDWGFGQILLGLLGAALLVMSSVVGDLTESMFKRRSGIKDSSNLLP GHGGVLDRIDSLTAAIPIFAVLLWAAEWGVM