Protein Info for PP_1585 in Pseudomonas putida KT2440

Annotation: putative Antidote protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 TIGR02607: addiction module antidote protein, HigA family" amino acids 6 to 85 (80 residues), 106.3 bits, see alignment E=2.8e-35 PF01381: HTH_3" amino acids 19 to 70 (52 residues), 28.4 bits, see alignment E=7.1e-11

Best Hits

Swiss-Prot: 42% identical to HIGA1_VIBCH: Antitoxin HigA-1 (higA-1) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_4192)

Predicted SEED Role

"HigA protein (antitoxin to HigB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MI6 at UniProt or InterPro

Protein Sequence (99 amino acids)

>PP_1585 putative Antidote protein (Pseudomonas putida KT2440)
MLKNGMRPIHPGEILREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLS
ICLDTTPEFWLNLQTAFDLRTAEQQHGDEIIGSVQRLVA