Protein Info for PP_1531 in Pseudomonas putida KT2440
Annotation: putative glutathione-dependent thiol reductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 47% identical to YFFB_ECOLI: Protein YffB (yffB) from Escherichia coli (strain K12)
KEGG orthology group: K00537, arsenate reductase [EC: 1.20.4.1] (inferred from 99% identity to ppf:Pput_4193)Predicted SEED Role
"FIG138056: a glutathione-dependent thiol reductase"
MetaCyc Pathways
- arsenate detoxification III (2/2 steps found)
- arsenic detoxification (bacteria) (3/4 steps found)
- arsenate detoxification I (4/6 steps found)
- arsenic detoxification (plants) (4/6 steps found)
- arsenic detoxification (yeast) (4/12 steps found)
Isozymes
Compare fitness of predicted isozymes for: 1.20.4.1
Use Curated BLAST to search for 1.20.4.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88MP0 at UniProt or InterPro
Protein Sequence (115 amino acids)
>PP_1531 putative glutathione-dependent thiol reductase (Pseudomonas putida KT2440) MTYTLYGIKACDTMKKARTWLEDKAIAYEFHDYKTQGIDRDSLNRWCDEHGWEVILNRAG TTFRKLDDASKADLDQAKAVELMLAQPSMIKRPVLDLGARTLVGFKPDLYAAALA