Protein Info for PP_1530 in Pseudomonas putida KT2440

Annotation: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03536: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase" amino acids 5 to 344 (340 residues), 638.5 bits, see alignment E=1.1e-196 PF14789: THDPS_M" amino acids 132 to 172 (41 residues), 58.2 bits, see alignment 6.8e-20 PF14602: Hexapep_2" amino acids 254 to 286 (33 residues), 47.5 bits, see alignment 1.1e-16

Best Hits

Swiss-Prot: 100% identical to DAPD_PSEPK: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (dapD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00674, 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC: 2.3.1.117] (inferred from 100% identity to ppu:PP_1530)

Predicted SEED Role

"2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117)" in subsystem Lysine Biosynthesis DAP Pathway (EC 2.3.1.117)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.117

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MP1 at UniProt or InterPro

Protein Sequence (344 amino acids)

>PP_1530 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (Pseudomonas putida KT2440)
MSNTLFSLAFGVGSQNRQGAWLEVFYAQPLLNPSAELVAAVAPVLGYEGGNQAIAFSNAQ
AAQLAEALKGVDAAQAALLTRLAESHKPLVATLLAEDAALSSTPEAYLKLHLLSHRLVKP
HGVSLAGIFPLLPNVAWTNQGAVDLGELAELQLEARLKGELLEVFSVDKFPKMTDYVVPA
GVRIADTARVRLGAYIGEGTTIMHEGFVNFNAGTEGPGMIEGRVSAGVFVGKGSDLGGGC
STMGTLSGGGNIVIKVGEGCLIGANAGIGIPLGDRNTVEAGLYITAGTKVNLLDENNELV
KVVKARDLAGQTDLLFRRNSLNGAVECKTHKSAIELNEALHAHN