Protein Info for PP_1526 in Pseudomonas putida KT2440

Annotation: putative Beta-(1-3)-glucosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 863 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 312 to 332 (21 residues), see Phobius details amino acids 344 to 361 (18 residues), see Phobius details amino acids 367 to 391 (25 residues), see Phobius details amino acids 681 to 707 (27 residues), see Phobius details amino acids 715 to 737 (23 residues), see Phobius details amino acids 749 to 771 (23 residues), see Phobius details amino acids 800 to 819 (20 residues), see Phobius details amino acids 826 to 847 (22 residues), see Phobius details PF13506: Glyco_transf_21" amino acids 408 to 658 (251 residues), 50.4 bits, see alignment E=3.2e-17 PF13641: Glyco_tranf_2_3" amino acids 421 to 649 (229 residues), 86.7 bits, see alignment E=4.1e-28 PF00535: Glycos_transf_2" amino acids 424 to 597 (174 residues), 84.2 bits, see alignment E=2.1e-27 PF13632: Glyco_trans_2_3" amino acids 510 to 702 (193 residues), 81.5 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1526)

Predicted SEED Role

"probable glucosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MP4 at UniProt or InterPro

Protein Sequence (863 amino acids)

>PP_1526 putative Beta-(1-3)-glucosyl transferase (Pseudomonas putida KT2440)
MSSRKFGLNLVVVLAIAALFTGFWALINRPVSAPAWPEQISGFSYSPFRLGESPQKGQYP
TDDEMRQDLEQLSKLTDSIRIYTVEGTQADVPRLAEEFGLRVTLGIWISPDLERNEREIA
TAIQLANTSRSVVRVVVGNEALFREEVTPENLIKYLDRVRAAVKVPVTTSEQWHIWKEHP
ELARHVDLIAAHILPYWEFVPMKDSVEFVLERARELKHQFPRKPLLLSEVGWPSNGRMRG
GADATQADQAIYLRTLVNTLNRRGYNYFVIEAYDQPWKASDEGSVGAYWGVYNAERQQKF
NFDGPVVAIPQWRALAVASVVLAMIALMVLFIDGSALRQRGRTFLTFITFLCGSVLVWIA
YDYSQQYSTWFSLTVGVLLALGALGVFIVLLTEAHELAEAVWIHKRRREFLPVQADTAYR
PKVSVHVPCYNEPPEMVKQTLDALAALDYPDYEVLVIDNNTKDPAVWEPLKAHCEKLGER
FKFFHVAPLAGFKGGALNYLIPHTAKDAEVIAVIDSDYCVDRNWLKHMVPHFADPKIAVV
QSPQDYRDQHESAFKKLCYSEYKGFFHIGMVTRNDRDAIIQHGTMTMTRRSVLEELGWAE
WCICEDAELGLRVFEKGLSAAYAHNSYGKGLMPDTFIDFKKQRFRWAYGAIQIIKHHAGA
LLRGKGSQLTRGQRYHFLAGWLPWIADGMNIFFTIGALLWSAAMIIVPHRVDPPLMIFAI
PPLALFFFKVGKIIFLYRRAVGVNLKDAFAAALAGLALSHTIAKAVLYGFFTSSMPFFRT
PKNADSHGLLVAISEAREELFIMVLLWGAALGIYLVQGLPSSDMRFWVAMLLVQSLPYVA
ALVMAFLSSLPKPAEKAAQAQQA