Protein Info for PP_1524 in Pseudomonas putida KT2440

Annotation: 23S rRNA m1G745 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF21302: Zn_ribbon_RlmA" amino acids 3 to 45 (43 residues), 73.1 bits, see alignment 4.8e-24 PF13489: Methyltransf_23" amino acids 69 to 132 (64 residues), 28.2 bits, see alignment E=5e-10 PF13847: Methyltransf_31" amino acids 85 to 125 (41 residues), 29 bits, see alignment 2.9e-10 PF08241: Methyltransf_11" amino acids 86 to 168 (83 residues), 39.2 bits, see alignment E=3.1e-13 PF13649: Methyltransf_25" amino acids 86 to 168 (83 residues), 48.7 bits, see alignment E=3.6e-16

Best Hits

KEGG orthology group: K00563, 23S rRNA (guanine745-N1)-methyltransferase [EC: 2.1.1.187] (inferred from 100% identity to ppf:Pput_4200)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase A (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.51

Use Curated BLAST to search for 2.1.1.187 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MP6 at UniProt or InterPro

Protein Sequence (270 amino acids)

>PP_1524 23S rRNA m1G745 methyltransferase (Pseudomonas putida KT2440)
MLACPLCQAPLSRLDNGVVCPAGHRFDRARQGYLNLLPVQHKNSRDPGDNQAMVEARRDF
LDAGHYAPVARRLAELAAERQPGAWLDIGCGEGYYTAQIAQALPAADGYALDISREAVKR
ACRRAPAVTWMVASMARVPLTDASCQFIASVFSPLDWAEAKRLLSPGGGLMRVGPTSGHL
MELREVLYDEVRPYADDKHLALVPEGMAHAHSETLEFRLSLAAPKARADLLAMTPHGWRA
SAEKRARVIDQPEPFEVTVSMRYDYFVRQD