Protein Info for PP_1493 in Pseudomonas putida KT2440

Annotation: chemotaxis response regulator protein-glutamate methylesterase of group 3 operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00072: Response_reg" amino acids 3 to 103 (101 residues), 60.2 bits, see alignment E=2.2e-20 PF01339: CheB_methylest" amino acids 155 to 331 (177 residues), 198.8 bits, see alignment E=6.1e-63

Best Hits

Swiss-Prot: 100% identical to CHEB3_PSEPK: Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon (cheB3) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K13491, two-component system, chemotaxis family, response regulator WspF [EC: 3.1.1.61] (inferred from 100% identity to ppf:Pput_4229)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MS5 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PP_1493 chemotaxis response regulator protein-glutamate methylesterase of group 3 operon (Pseudomonas putida KT2440)
MKIAIVNDMPLAVEALRRAVALEPAHQVVWVASNGAEAVQRCTEQLPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDRKQNVHRVFEAMGHGALDVVDTPALGAGDAREAAAPLL
RKILNIGWLVGQQRAPAARSVAAPLREASQRRGLVAIGSSAGGPAALEVLLKGLPAAFPA
AIVLVQHVDQVFAAGMAEWLSSAAGLPVRLAREGEPPQPGQVLLAGTNHHIRLLQNGQLA
YTAEPVNEIYRPSIDVFFESVARYWNGDAVGVLLTGMGRDGAQGLKLMRQQGFLTIAQDQ
ASSAVYGMPKAAAAIDAAVEIRPLERIAGRLTEFFAK