Protein Info for PP_1492 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 762 PF01627: Hpt" amino acids 11 to 97 (87 residues), 51.3 bits, see alignment E=2.2e-17 PF02518: HATPase_c" amino acids 340 to 479 (140 residues), 50.6 bits, see alignment E=5e-17 PF01584: CheW" amino acids 486 to 614 (129 residues), 75.5 bits, see alignment E=6.5e-25 PF00072: Response_reg" amino acids 641 to 753 (113 residues), 88.4 bits, see alignment E=7.3e-29

Best Hits

KEGG orthology group: K13490, two-component system, chemotaxis family, sensor histidine kinase and response regulator WspE (inferred from 100% identity to ppu:PP_1492)

Predicted SEED Role

"Sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MS6 at UniProt or InterPro

Protein Sequence (762 amino acids)

>PP_1492 Sensor histidine kinase/response regulator (Pseudomonas putida KT2440)
MTPEQMRDASLLELFSLEAEAQTQVLNAGLMALERNPTQADQLEACMRAAHSLKGAARIV
GVDAGVSVAHVMEDCLVAAQEGRLRLTAEHIDALLQGTDLLMRIATPGDAGAQATLPVFL
AQMASLLDPGASAMPVVPPAASVPPLATLPPAPMVMPAEPPEPEPEPALRRKAGKRAGEG
AERVLRVTADRLNSLLDLSSKSLVETQRLKPYLATLQRLKRMHGQGMQALDGLRMQLEDT
GQGNEVLEALAQTQRLLAETQRILQQQAADLDEFGWQASQRAQLLYDTALACRMRPFADV
LTGQSRMVRDLGRSLGKPVRLVVEGEKTQVDRDVLEKLEAPLTHLLRNAVDHGIELPERR
LLAGKPDEGVIRLRASHQAGMLSLELIDDGAGIDLERLRSSIVERALSPADTVARMSEAE
LLTFLFLPGFSLRDKVTEVSGRGVGLDAVQHLIRELRGSIELTQVAGQGCRFHLQVPLTL
SVVRSLVVEVGGEAYAFPLAHIERTLEVTAEQIVQIEGRQHFWHEGRHIGLVAASQLLNR
PAGQSDEASLRVVVIREREQLYGVAVERLVGERVLVVMPLDPRLGKVQDISSGALLDDGS
VVLIVDVEDLLRSLEKLLSTGSLERIERGSSGARGVVRKRILVVDDSLTVRELQRKLLGN
RGYDVAVAVDGMDGWNALRSEDFDLLITDIDMPRMDGIELVTLVRRDQRLQSLPVMVVSY
KDREEDRRRGLDAGADYYLAKASFHDDALLDAVVELIGVAQG