Protein Info for PP_1482 in Pseudomonas putida KT2440

Annotation: polyamine ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 248 (169 residues), 48.8 bits, see alignment E=3.5e-17

Best Hits

Swiss-Prot: 80% identical to YDCV_ECOLI: Inner membrane ABC transporter permease protein YdcV (ydcV) from Escherichia coli (strain K12)

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to ppf:Pput_4239)

MetaCyc: 80% identical to putative ABC transporter membrane subunit YdcV (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MT6 at UniProt or InterPro

Protein Sequence (268 amino acids)

>PP_1482 polyamine ABC transporter, permease protein (Pseudomonas putida KT2440)
MHSEKASAGLRLAAWGGLLFLHFPILIIFLYAFNTEDAAFSFPPKGFTLKWIDVAFTRPD
VLEAIKLSLQVACLATLIALVLGTLASAALYRRSFFGKESISLVLILPIALPGIITGIAL
LSAFKTLGIEPGVFTIVVGHATFCVVIVYNNVIARLRRTSQSLIEASMDLGADGWQTFRY
IVLPNLGSALLAGGMLAFALSFDEIIVTTFTAGHERTLPIWLLNQLSRPRDVPVTNVVAM
LVMLVTMLPILGAYYLTRGGDSVAGGGK