Protein Info for PP_1462 in Pseudomonas putida KT2440

Annotation: 30S ribosomal protein S16

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 TIGR00002: ribosomal protein bS16" amino acids 28 to 104 (77 residues), 97.3 bits, see alignment E=2e-32 PF00886: Ribosomal_S16" amino acids 34 to 94 (61 residues), 90 bits, see alignment E=3.7e-30

Best Hits

KEGG orthology group: K02959, small subunit ribosomal protein S16 (inferred from 65% identity to cja:CJA_1433)

Predicted SEED Role

"SSU ribosomal protein S16p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>PP_1462 30S ribosomal protein S16 (Pseudomonas putida KT2440)
MCLFGIQICSTSCCINCSTDYRNDVHMVTIRLARGGSKKRPFYHLTVTNSRNARDGRFVE
RVGFFNPIAAGAEVKLSVNQERVTYWLSQGAQPSERVAQLLKEAAKAAA