Protein Info for PP_1460 in Pseudomonas putida KT2440

Annotation: putative Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 141 to 167 (27 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 226 to 243 (18 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 54 to 280 (227 residues), 132.3 bits, see alignment E=1e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1460)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88MV8 at UniProt or InterPro

Protein Sequence (283 amino acids)

>PP_1460 putative Membrane protein (Pseudomonas putida KT2440)
MPNSVSLKARQPGLMFSSPSLIPNLIAAGLYIAAAIYQGSYLSQGRKAEKRLLGLLGAIA
VLAQAGALFFQLITPLGLSLDFFSAASLIAVAVISLTLLACLRIPVENLLVLLFPLGAVT
ALLAQFAPPGTVPLINEEPGILAHILLSILAYGLFTIAVFQSLLLLLQDRQLKNKHPSGL
IRNFPPLQTMESLLFGFLWAGWCLLSLSLISGWLFLDNLFAQHLAHKTLLACVAWVVFSV
LLWGRTRLGWRGHMAIRWTLSGFCLLMLAYFGSKLVREFILHI